PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002725-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 384aa    MW: 43119.2 Da    PI: 6.7006
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002725-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14.1e-081444131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     rg W+++Ed++l+ +++ +G g+W++++r  
  AHYPO_002725-RA 14 RGLWSPQEDQKLISYITTFGHGSWSSVPRLA 44
                     788************************9975 PP

2Myb_DNA-binding48.91.5e-154890145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg+++++E  l++d+++ lG++ W+ Ia++++ gRt++++k++w+
  AHYPO_002725-RA 48 RGSFSPQEAALIIDLHRILGNR-WSQIAKYLP-GRTDNEVKNFWN 90
                     899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-11543IPR009057Homeodomain-like
SuperFamilySSF466894.87E-191189IPR009057Homeodomain-like
SMARTSM00717901345IPR001005SANT/Myb domain
PfamPF002499.7E-61443IPR001005SANT/Myb domain
PROSITE profilePS5129422.6744397IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-214597IPR009057Homeodomain-like
SMARTSM007174.2E-154795IPR001005SANT/Myb domain
PfamPF002496.5E-144891IPR001005SANT/Myb domain
CDDcd001673.92E-115090No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGHHTCCNKQ KVKRGLWSPQ EDQKLISYIT TFGHGSWSSV PRLADLKRGS FSPQEAALII  60
DLHRILGNRW SQIAKYLPGR TDNEVKNFWN SSIKKKLLSQ VVANNTTNNN PNLISNNHHH  120
LNYLPNNTFL NNLIDHNHHI VEEFPPFLPL ISNSNISPNY LLNPLKNHNY NQEQIPNLIN  180
NSNQSINPII QGFDNLDHTF IPPINNSSYD PTFSSLGFHD LVNEVGITNN HSLDYQFGNS  240
HESCIQSSSI IHPSSYHDDH NETIMKMKLT PMMPKLETMI SFEGEVSNTM PSSLTSHYHD  300
HDYTYHTIPK PALITPLCIP NQQVLEYYLN HEDHDEHHVM LPSSSSSSSS PPPPSSSLAV  360
LPCCGSGAVM NPSIIPSTSS WNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1914977108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685365.11e-92PREDICTED: protein ODORANT1
TrEMBLA0A0J8BUS21e-92A0A0J8BUS2_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.26e-53myb domain protein 26